Total number of results for Saimiri sciureus are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02419 |
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
|
29 | Saimiri sciureus | Glucagon | Glucagon | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
| NP02728 |
FVNQHLCGPHLVEALYLVCGERGFFYAPKT
|
30 | Saimiri sciureus | Insulin | Insulin B chain | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
| NP02729 |
GVVDQCCTSICSLYQLQNYCN
|
21 | Saimiri sciureus | Insulin | Insulin A chain | 2263627#Yu J.-H., Eng J., Yalow R.S.#Isolation and amino acid sequences of squirrel monkey (Saimiri sciurea) insulin and glucagon.# Proc. Natl. Acad. Sci. U.S.A. 87:9766-9768(1990). | |
| NP05318 |
MDPNAAYMNTSRHHRVLASVNADFAFSLYKHLVALSPKKNVFISPVSISMALAMLSLGTCGHTRAQLLHGLGFNLTEKSEAEIHQSFQHLHQLLAESDSSLEMTLGNALFLDGSLELLESFSADIKHYYESEVLTLNFQDWATTASRQINGYVKSKTQGKIDDLFSGLNSPAVLILINYIFFKGTWKQPFDLASTREENFYVDETTVVKVPMMFQSGTIRYLHDSELPCQLVQLNYAGNGTVFFILPEKGKMNIVITALSRNTIDRWSAGLTRSQVDLYIPKVTISGAYDFGGVLEDMGIADLFTNHANFSRITQDAQLKLSKVFHKAVLQLSEEGVNTTGSTGVTLNPMSKPIIMRFNQPFLIMVFDHFTWSSLFLGRVVNPA
|
384 | Saimiri sciureus | Serpin | Corticosteroid-binding globulin |